PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 826aa    MW: 93684.8 Da    PI: 5.6357
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783721.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK505.9e-16637681448
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                      is ++l+++F +++ dAAk+Lgv  ++LKr CR y I RWP+ k
  XP_009783721.1 637 GISRSVLEEQFGKKLSDAAKSLGVARSTLKRMCRDYDIYRWPRSK 681
                     6999**************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.866619707IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.2E-4622673IPR009057Homeodomain-like
PfamPF020424.2E-13638681IPR003035RWP-RK domain
SuperFamilySSF542776.54E-17739824No hitNo description
PROSITE profilePS5174519.571742826IPR000270PB1 domain
PfamPF005648.0E-15742824IPR000270PB1 domain
SMARTSM006667.1E-16742825IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.9E-15743823No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MRERKRNDGI NRWVFWTQHN GDELNQVKSL FPILRDSTQP DTNGDCQLNR LTIKNLVELL  60
DVQGTCLIQF WSPIRNNGGK TFLTTADQPF SFNGKIHEGL WAYRRVSLHT IASVDATEID  120
ETKRICVHGR PARVFRSGMP EFSPHVRYYY MDEYPLRNFA MCLGVGSYWT LPVFESSGDR  180
CIGVLEYAFE ANVGLDLYSI LDRLINNHRI LKTMGLALIP SWLACPQEIQ EVWEQELAQV  240
KEALDVTCKT HMLLFAQTWI PVLDSSRTQM LITSPPTKYW SEEISSLEFL AVSDLHHVQI  300
GQGLVGKVLS SKGSCFCRDI TQLSIDFYPL VPIARCAGFT ACFAIFVRLN SACHMVLEFF  360
LPRDEMLDRN PQSFLSKLLA TIREQLPSFF LDSGPSLFVE VIRTAPVDEL DSFEINQPQQ  420
VVRSKGNEKV VHFDSLNQDT ADLGPSSSTD IGAHYMEITN HTPDNGEETV LQDSAHKQGV  480
EEADAMDKEK SSVHFKENKF AYTDSDILAT SFVDSEQNLS TDKASLDEKL DSFKIGHRQL  540
PSMVQYNTIN QIFGFDPSSS SDLEEIVTAD YGRDTQMNLQ SKKRGESTQP DSAHQQTVEE  600
ADVADKRKHS VHVEENTNSQ NCPEKHKRIK RIEKEYGISR SVLEEQFGKK LSDAAKSLGV  660
ARSTLKRMCR DYDIYRWPRS KSANDVCSLS ENKPVKRVEK QMGNSSREDL QLPHASLSNG  720
MDTTTTLTQR KVPIATFQSD NTMSVKVTYK DVTIRFPLSL SSGKIDLETE VEKRLKLVPV  780
GSYSIKYEDE DNDWIAITCD SDLEYGIHTL RSLGRTTMKM LVEPLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783721.10.0PREDICTED: protein NLP7-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-46Nin-like family protein